PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_C2A825B6D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 81aa    MW: 9164.46 Da    PI: 10.8445
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_C2A825B6D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY68.88e-224281140
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE CS
                   WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkver 40
                           ldDg++WrKYG+K vk+s++pr+YYrC+ +gC  kk+ver
  Traes_4AL_C2A825B6D.1 42 LDDGFKWRKYGKKAVKNSPNPRNYYRCSAEGCGIKKRVER 81
                           59*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-223081IPR003657WRKY domain
SuperFamilySSF1182908.5E-203481IPR003657WRKY domain
PROSITE profilePS5081122.9743781IPR003657WRKY domain
SMARTSM007742.8E-124281IPR003657WRKY domain
PfamPF031061.4E-164381IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MAQVSFAGAG DDKHRSEKTI KISARVSAGR IGFRTRSEVE ILDDGFKWRK YGKKAVKNSP  60
NPRNYYRCSA EGCGIKKRVE R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-212781256Probable WRKY transcription factor 4
2lex_A4e-212781256Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3571961e-113AK357196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048A03.
GenBankAK3670651e-113AK367065.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2050M16.
GenBankDQ8404161e-113DQ840416.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 17 (WRKY17) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654120.15e-34PREDICTED: probable WRKY transcription factor 51
SwissprotQ8VWQ53e-29WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLR7W3P83e-53R7W3P8_AEGTA; Putative WRKY transcription factor 50
TrEMBLW5DTA87e-54W5DTA8_WHEAT; Uncharacterized protein
STRINGMLOC_12079.19e-51(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-30WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]